SEARCH

SEARCH BY CITATION

As a service to our authors and readers, this journal provides supporting information supplied by the authors. Such materials are peer reviewed and may be re-organized for online delivery, but are not copy-edited or typeset. Technical support issues arising from supporting information (other than missing files) should be addressed to the authors.

FilenameFormatSizeDescription
pmic7555-sup-0001-FigureS1.ppt321KFigure S1. Mass spectra and tandem mass spectra. (A) Mass spectra (m/z 850–1000) from endoproteinase Glu-C digests of the Rpt1 subunit from yeast wild-type and PK-deletion strains. (B) Tandem mass spectra of signals at m/z 914.4, m/z 928.4, and m/z 3553.0. Tandem mass spectra of signals at m/z 914.4 and m/z 928.4 revealed sequences corresponding to the N-terminal peptide of yeast Rpt1 (PPKEDWE) mono- and di-methylated at the Pro residue that is N-terminal following removal of the initiation Met. Tandem mass spectrum of the signal at m/z 3553.7 revealed a sequence corresponding to the unmodified N-terminal peptide of yeast Rpt1 (PPKEDWEKYKAPLEDDDKKPDDDKIVPLTE). (C) Tandem mass spectrum of the signal at m/z 1162.5. This mass spectrum revealed a sequence corresponding to the unmodified N-terminal peptide of human Rpt1 (PDYLGADQRK). (D) Tandem mass spectrum of the signal at m/z 3459.6. This mass spectrum revealed a sequence corresponding to the unmodified N-terminal peptide of yeast Rpt1 (MPEDWEKYKAPLEDDDKKPDDDKIVPLTE) with the initiation Met but without the PK sequence. Fragment ions of the a-, b- and y-series identified in the tandem mass spectra from each peptide are shown in the figure.
pmic7555-sup-0002-TableS1.xls36KTable S1. Identification of yeast proteasome subunits

Please note: Wiley Blackwell is not responsible for the content or functionality of any supporting information supplied by the authors. Any queries (other than missing content) should be directed to the corresponding author for the article.