SEARCH

SEARCH BY CITATION

Keywords:

  • PDR transporter;
  • herbivory;
  • Manduca sexta ;
  • biotic stress;
  • Nicotiana tabacum ;
  • Nicotiana plumbaginifolia

Summary

  1. Top of page
  2. Summary
  3. Introduction
  4. Results
  5. Discussion
  6. Experimental procedures
  7. Acknowledgments
  8. References
  9. Supporting Information

Pleiotropic drug resistance (PDR) transporters are a group of membrane proteins belonging to the ABCG sub-family of ATP binding cassette (ABC) transporters. There is clear evidence for the involvement of plant ABC transporters in resistance to fungal and bacterial pathogens, but not in the biotic stress response to insect or herbivore attack. Here, we describe a PDR transporter, ABCG5/PDR5, from Nicotiana tabacum. GFP fusion and subcellular fractionation studies revealed that ABCG5/PDR5 is localized to the plasma membrane. Staining of transgenic plants expressing the GUS reporter gene under the control of the ABCG5/PDR5 transcription promoter and immunoblotting of wild-type plants showed that, under standard growth conditions, ABCG5/PDR5 is highly expressed in roots, stems and flowers, but is only expressed at marginal levels in leaves. Interestingly, ABCG5/PDR5 expression is induced in leaves by methyl jasmonate, wounding, pathogen infiltration, or herbivory by Manduca sexta. To address the physiological role of ABCG5/PDR5, N. tabacum plants silenced for the expression of ABCG5/PDR5 were obtained. No phenotypic modification was observed under standard conditions. However, a small increase in susceptibility to the fungus Fusarium oxysporum was observed. A stronger effect was observed in relation to herbivory: silenced plants allowed better growth and faster development of M. sexta larvae than wild-type plants, indicating an involvement of this PDR transporter in resistance to M. sexta herbivory.


Introduction

  1. Top of page
  2. Summary
  3. Introduction
  4. Results
  5. Discussion
  6. Experimental procedures
  7. Acknowledgments
  8. References
  9. Supporting Information

ATP binding cassette (ABC) transporters form a large group of proteins in organisms from all kingdoms of life (Kos and Ford, 2009). Membrane-bound ABC transporters perform active transport of molecules across biological membranes energized by ATP hydrolysis. They consist of one or two transmembrane domains (TMDs) and one or two nucleotide-binding domains (NBDs), which contain the characteristic Walker A and Walker B motifs as well as the ABC signature motif. Depending upon the organization of these structural elements, ABC transporters are classified into different sub-families (Verrier et al., 2008). The ABCG sub-family contains half- and full-size transporters organized in the so-called reverse orientation (NBD–TMD and NBD–TMD–NBD–TMD, respectively). Full-size ABCG transporters, also called pleiotropic drug resistance (PDR) transporters, have only been identified in plants, fungi, oomycetes, brown algae and slime molds (Kang et al., 2011). In plants, PDR transporters have been shown to be involved in a variety of functions, including defense against pathogens, resistance to cadmium, lead and high salt concentrations, formation of the cuticular layer, and transport of antimicrobial terpenoids, auxin derivatives, abscisic acid and strigolactone (Jasinski et al., 2001; Lee et al., 2005; Ito and Gray, 2006; Stein et al., 2006; Kim et al., 2007, 2010; Bultreys et al., 2009; Krattinger et al., 2009; Strader and Bartel, 2009; Yazaki et al., 2009; Kang et al., 2010; Ruzicka et al., 2010; Bessire et al., 2011; Kretzschmar et al., 2012).

The involvement of PDRs in resistance to pathogens has been demonstrated comprehensively across plant species. In Nicotiana plumbaginifolia, NpPDR1 has been shown to function in the transport of diterpenes such as sclareol and in resistance to fungal pathogens (Jasinski et al., 2001; Stukkens et al., 2005; Bultreys et al., 2009). Recently it was shown that growth inhibition of Ralstonia solanacearum on Arabidopsis or tobacco plants by pre-treatment with sclareol was attenuated in AtPDR12 knockout or NtPDR1-silenced plants, respectively, suggesting that these PDR transporters function in resistance against bacterial wilt disease (Seo et al., 2012). In Arabidopsis, deletion of ABCG36/PDR8 leads to increased susceptibility to Pseudomonas syringae infections (Kobae et al., 2006), while the importance of the PDR transporter Lr34 in resistance to multiple fungal pathogens has been demonstrated in wheat (Krattinger et al., 2009). Despite several cases of PDR transporters being implicated in the resistance of various plant species to pathogens, no PDR, or other ABC transporter, has yet been shown to be involved in resistance to insects or herbivores.

Plants have developed mechanisms to differentiate biotic damage due to insects and herbivores from abiotic wounding and stresses. Detection is mediated by recognition of pathogen- or herbivore-specific mediators, such as pathogen-specific avirulence factors or fatty acid–amino acid conjugates in the oral secretions of chewing insects (Bisgrove et al., 1994; Wu et al., 2007). Plants respond in an attack-specific manner by reallocating resources, and by mounting both specific and general inducible defenses. Alterations in primary metabolites occur as in differential regulation of photosynthesis or photosynthetic genes in damaged tissue (Welter, 1989; Hui et al., 2003), and changes in source–sink relationships, which is reflected in up-regulation of sugar transporters in damaged tissues immediately following wounding, for example (Meyer et al., 2004; Schwachtje and Baldwin, 2008). Indirect defenses function to attract natural enemies of the perceived herbivore, for example production of green leaf volatile compounds to attract natural predators of herbivores (Baldwin et al., 2001; Allmann and Baldwin, 2010). Direct defenses target specialists or generalists or entire classes of herbivores, and include physical barriers, such as trichomes or waxes, and the production of inducible chemical defense compounds, such as secondary metabolites (Arimura et al., 2005).

One example of a herbivore-specific defense response in Nicotiana species is the induced response to herbivory by larvae of the nicotine-tolerant lepidopteran Manduca sexta, a Solanaceae specialist (Wu and Baldwin, 2010). These responses have been studied most extensively in the wild tobacco Nicotiana attenuata, especially initiation of changes at the transcriptomic, proteomic and metabolomic level (Wu et al., 2007). The induced defense compounds include trypsin protease inhibitors (van Dam et al., 2001; Zavala and Baldwin, 2004), anti-nutritive enzymes, such as polyphenol oxidases (Karban et al., 2000), nicotine (Steppuhn et al., 2004), diterpene glycosides (Jassbi et al., 2008; Heiling et al., 2010), and the phenylpropanoid–polyamine conjugates caffeoylputrescine and dicaffeoylspermidine (Kaur et al., 2010).

Importantly, in both laboratory and field studies, herbivore performance has been correlated with levels of inducible defense compounds. Transgenic N. attenuata plants silenced for the putrescine N-methyl transferase (pmt) gene demonstrated a whole-plant decrease in nicotine content and corresponding improved M. sexta performance in the laboratory. When planted in their native habitat, the plants showed greater susceptibility to herbivory in terms of the variety of herbivore species that attack them and the leaf area lost (Steppuhn et al., 2004).

While numerous studies have identified genes involved in the production of secondary metabolites or in the signaling cascade transmitting attack signals, little is known about the transporters involved in facilitating the translocation of defense or signaling compounds to and from the site of physical damage.

Here, we identified ABCG5/PDR5, a full-size PDR transporter from Nicotiana tabacum, expression of which is negligible in leaves under standard growth conditions, but that is induced by treatment with methyl jasmonate (MeJA), wounding, and herbivory by the specialist herbivore Msexta. Furthermore, silencing of ABCG5/PDR5 expression results in faster growth and development of M. sexta, indicating an important role for ABCG5/PDR5 in herbivore performance.

Results

  1. Top of page
  2. Summary
  3. Introduction
  4. Results
  5. Discussion
  6. Experimental procedures
  7. Acknowledgments
  8. References
  9. Supporting Information

Cloning of ABCG5/PDR5

Using degenerate primers corresponding to highly conserved regions in PDR genes, and RNA from N. plumbaginifolia roots, we obtained a partial cDNA for an unknown PDR gene. As this gene, named NpABCG5/PDR5, belonged to a PDR sub-family previously uncharacterized in a Nicotiana species, we obtained a full cDNA from root RNA by RACE RT-PCR. The cDNA contains a 4497 bp open reading frame encoding a 1499 amino acid protein with a predicted size of 170 kDa. An in-frame stop codon was found upstream of the initiation codon, indicating that no N-terminal sequence was missing (Figure S1).

Homologs of NpABCG5/PDR5 from N. tabacum were also amplified, and two sequences, NtABCG5/PDR5a and NtABCG5/PDR5b, were obtained and found to share high nucleotide identity with NpABCG5/PDR5 (97.6 and 98.0%, respectively). As N. tabacum is an amphitetraploid, these sequences probably represent orthologs originating from the two ancestors, Nicotiana tomentosiformis and Nicotiana sylvestris. This was confirmed by PCR on genomic DNA extracted from N. tomentosiformis and N. sylvestris using ortholog-specific primers (Figure 1).

image

Figure 1. ABCG5/PDR5 has two orthologs in N. tabacum. PCR on N. tabacum genomic DNA with specific primers for the two orthologs present in the genome (a, forward 5′-TAGACTTCGAATCAGCCAG-3′, reverse 5′-GAACTGGTACGACTGCTCA-3′; b, forward 5′-CCCAAGACTTAAAATCAGCCAGT-3′, reverse 5′-TGGATATGACTGCTCATTCGTC-3′). A non-specific region in ABCG5/PDR5 was chosen as a control (forward 5′-GGCACAACTAGATTGGGTCTG-3′; reverse 5′-CTTTGCTGCGACACCATTT-3′) (bottom panel).

Download figure to PowerPoint

Phylogenetic analysis revealed that the NtABCG5/PDR5 and NpABCG5/PDR5 sequences aligned with known PDR transporter genes in cluster III (Figure S2). The closest ABCG5/PDR5 homologs were found to be Arabidopsis AtABCG35/PDR7 and AtABCG36/PDR8, with approximately 74% amino acid identity. The deduced ABCG5/PDR5 amino acid sequence contained the typical PDR and ABC transporter motifs (Figure S3).

Expression of ABCG5/PDR5 in organs and tissues

In order to determine the expression profile of ABCG5/PDR5, an antibody was generated against a 61 amino acid sequence in a region unique to ABCG5/PDR5 (Figure S4). Immunoblotting analysis of various plant tissues showed that ABCG5/PDR5 expression was high in the petals, stem and roots, but weak in the whole leaf, although it was enriched in epidermal strips (Figure 2a).

image

Figure 2.  ABCG5/PDR5 expression analysis in various plant tissues and organs. (a) Immunoblotting of microsomal fractions of various tissues and organs of N. tabacum plants using an ABCG5/PDR5-specific antibody and a general anti-H+-ATPase antibody as the loading control. (b–h) Analysis of GUS staining in ProPDR5:GV transgenic plants grown either hydroponically (root) or on soil (aerial tissue). (b) Petal, (c) stem, (d) leaf, (e) root with side roots, (f) cross-section of the mature part of the root, (g) root tip and elongation zone, (h) cross-section of the root tip. In (h), GUS staining was performed for a shorter time period compared to (g) to improve visualization of expression in the epidermis. Scale bars = 0.5 mm (b,c), 0.1 mm (d), 1 cm (e,g) and 50 μm (f,h).

Download figure to PowerPoint

To confirm the ABCG5/PDR5 expression profile, we cloned its transcription promoter region by inverted PCR and obtained a 1479 bp genomic fragment upstream of the translation initiation codon. The putative promoter sequence (ProPDR5) was fused to the hybrid reporter gene, GUSVENUS (GV) (Navarre et al., 2011) and introduced into N. tabacum plants by Agrobacterium tumefaciens-mediated transformation. Twenty kanamycin-resistant ProPDR5:GV plants that showed GUS expression were selected. GUS activity was consistently detected in the petals (Figure 2b), stem (Figure 2c) and roots (Figure 2e,g), and at a low level in leaves (Figure 2d). Microscopic analysis of cross-sections of roots showed staining in the outer cell layers (Figure 2f,h).

ABCG5/PDR5 is localized in the plasma membrane

In order to determine the subcellular localization of ABCG5/PDR5, ABCG5/PDR5–GFP and GFP–ABCG5/PDR5 fusion proteins were transiently expressed in N. tabacum and N. benthamiana leaves. Both fusion proteins were detected as a thin ring at the periphery of epidermal cells and co-localized with FM4-64, a marker labeling the plasma membrane, shortly after its infiltration (Figure S5). As the tonoplast is located in close proximity to the plasma membrane in epidermal cells, we used a YFP fusion to tonoplast intrinsic protein 2;1 (AtTIP2;1–YFP) located in the tonoplast to distinguish these two membranes and localize ABCG5/PDR5 more precisely. The GFP signal resulting from GFP–ABCG5/PDR5 (Figure 3a) co-localized with FM4-64 (Figure 3c) but was distinct from the YFP signal of TIP2;1–YFP (Figure 3e), demonstrating the plasma membrane localization of ABCG5/PDR5. As an additional control, we used a marker for the endoplasmic reticulum, CFP–HDEL. Although some GFP–ABCG5/PDR5 co-localized with CFP–HDEL, most likely protein that is passing through the secretory pathway to the plasma membrane, the majority of the GFP signal was distinct from CFP–HDEL (Figure 3g–i), which is in agreement with the plasma membrane localization of ABCG5/PDR5.

image

Figure 3.  Subcellular localization of ABCG5/PDR5. (a–c) Localization of (a) the GFP–PDR5 fusion protein and (b) the plasma membrane marker FM4-64 (b). (c) Merged image. (d) Localization of AtTIP2;1–YFP as a marker for the vacuolar membrane. (e,f) Merged images of (e) GFP–PDR5 and AtTIP2;1–YFP, and (f) FM4-64 and AtTIP2;1–YFP (f). (g–i) Localization of (g) GFP–PDR5 and (h) CFP–HDEL as a marker of the endoplasmic reticulum. (i) Merged image. (j) Immunoblotting of the microsomal fraction (MF) and plasma membrane-enriched fraction (PMF) from N. tabacum roots using an ABCG5/PDR5-specific antibody, a general anti-H+-ATPase antibody and an anti-Nt-TIPa antibody. Scale bars = 10 μm (a–f) and 6 μm (g–i).

Download figure to PowerPoint

To confirm the plasma membrane localization of ABCG5/PDR5, a plasma membrane-enriched fraction was isolated from N. tabacum roots and subjected to immunoblotting, using an antibody recognizing the H+-ATPase (Morsomme et al., 1998) as a positive control for the plasma membrane and an antibody recognizing the tonoplast intrinsic protein Nt-TIPa (Gerbeau et al., 1999) as a negative control. As shown in Figure 3(j), ABCG5/PDR5 was enriched in the plasma membrane fraction like the H+-ATPase and unlike Nt-TIPa, confirming its plasma membrane localization.

ABCG5/PDR5 expression is induced by methyl jasmonate

The sequence of the ABCG5/PDR5 promoter region revealed the presence of a T/G box motif (5′-AACGTG-3′) at position -456 bp (Figure S1), which has been shown to be involved in the MeJA response in Arabidopsis (Guerineau et al., 2003; Boter et al., 2004). In order to study the effect of hormone treatment on ABCG5/PDR5 expression, we submerged leaves of wild-type N. tabacum plants for 16 h in water or 500 μm MeJA. Non-submerged leaves from intact plants were used as a control. As shown in Figure 4(a), the abundance of ABCG5/PDR5 transcript resulting from MeJA-submerged leaves was increased compared to the water- and non-treated samples. The plant tissues used in Figure 4(a) were fractionated and used to extract RNA from which cDNA was synthesized and to prepare microsomal fractions to analyze protein expression. ABCG5/PDR5 expression was strongly induced by the presence of MeJA (Figure 4b). Interestingly, submersion in water increased ABCG5/PDR5 protein expression (Figure 4b), but this difference was not seen at the RNA level (Figure 4a). This may indicate that ABCG5/PDR5 expression is regulated at the post-transcriptional level. To confirm the expressional regulation of ABCG5/PDR5, GUS activity was measured on soluble protein extracts of leaves from ProPDR5:GV plants (Figure 4c). In non-treated leaves, GUS activity was low but increased significantly when the leaves were submerged in water, and even more so in the presence of MeJA, with GUS activity after MeJA treatment being significantly higher than in the non-treated and water-treated samples.

image

Figure 4.  Induction of ABCG5/PDR5 expression by MeJA. (a) Semi-quantitative PCR on cDNA of N. tabacum leaves taken directly from the plant (Fresh) or after submersion for 16 h in water + methanol (Water) or 500 μm methyl jasmonate (MeJA). Primers specific for ABCG5/PDR5 were used to follow ABCG5/PDR5 transcript abundance (forward 5′-GGCACAACTAGATTGGGTCTG-3′; reverse 5′-CTTTGCTGCGACACCATTT-3′). NtATP2, encoding the beta-subunit of mitochondrial ATP synthase (Boutry and Chua, 1985), was used as a loading control (forward primer 5′-TCTTTGCTGGTGTTGGTGAA-3′; reverse primer 5′-TGAGCTCATCCATACCCAAA-3′). (b) Microsomal fractions of the same material as used in (a) were probed using an ABCG5/PDR5-specific antibody and a general anti-H+-ATPase antibody as a loading control. (c) Leaves of ProPDR5:GV transgenic plants were either directly taken from the plant (Fresh) or submerged in water + methanol (Water) or 500 μm MeJA (MeJA) for 16 h. GUS activity was measured as pmol 4-MU (methyl umbellifoerone) per μg protein per minute using a fluorimeter. Standard errors are shown. Asterisks indicate statistically significant differences compared with wild-type (*< 0.05, **< 0.001, Student’s t-test).

Download figure to PowerPoint

ABCG5/PDR5 expression is induced upon wounding

MeJA is involved in a number of physiological processes, including responses to pathogen attack and wounding (Creelman and Mullet, 1997). As stated earlier, the promoter region of ABCG5/PDR5 contains a T/G box motif that has not only been shown to be responsive to MeJA, but is also found in promoters of genes whose expression is induced upon wounding (Delessert et al., 2004). This prompted us to examine the responsiveness of ABCG5/PDR5 expression to wounding. N. tabacum plants were wounded either by forceps pressure without rupturing the leaf or by perforating the leaf (Figure S6), and microsomal fractions were prepared 16 h later. Control samples were taken from a non-injured area of the wounded leaf and from systemic leaves. As shown in Figure 5, both methods of wounding resulted in a marked increase in ABCG5/PDR5 expression in leaves, whereas expression remained marginal in a non-injured area of the wounded leaf and in systemic leaves. In order to study induction of ABCG5/PDR5 expression over time and to determine whether it remained local or became systemic, we isolated microsomal fractions of wounded leaf areas at 1–72 h after wounding, and from non-wounded areas of the wounded leaf and of systemic leaves at the same time. As shown in Figure 5(b,c), induction of ABCG5/PDR5 expression was observed at 7 h after wounding in the wounded area, and remained high to at least 72 h after wounding, whereas ABCG5/PDR5 expression did not change over time in the non-injured areas of the wounded leaf or systemic leaf. Thus, induction of ABCG5/PDR5 expression is restricted to the wounded area, implying that the protein plays a major role close to the region of infection or physical damage.

image

Figure 5.  Induction of ABCG5/PDR5 expression by wounding. (a) Microsomal fractions of N. tabacum leaves wounded by forceps pressure (Wounded) or non-wounded tissue on the same leaf (Same leaf), and of a systemic leaf (Systemic) were probed using an ABCG5/PDR5-specific antibody and a general anti-H+-ATPase antibody as a loading control. (b,c) Immunoblotting of leaf microsomal fractions taken from wounded tissue (Wounded) or tissue from a non-wounded area on the same leaf (Same leaf) (b), or from a region on the leaf that was perforated with a metal fabric pattern wheel (Perforated) and a systemic leaf (Systemic) (c) at various times after wounding using the same antibodies as in (a).

Download figure to PowerPoint

ABCG5/PDR5 expression is induced upon pathogen infiltration

Expression of a number of PDR transporters has been shown to be induced following pathogen infiltration or infection (Stukkens et al., 2005; Ruocco et al., 2011). We therefore investigated ABCG5/PDR5 expression following infiltration of leaves with Fusarium oxysporum, Rhizoctonia solani, Phytophthora nicotianae or Botrytis cinerea. Immunoblotting showed that ABCG5/PDR5 expression was strongly induced by P. nicotianae, while F. oxysporum and R. solani had a smaller effect, and B. cinerea even less (Figure 6).

image

Figure 6.  ABCG5/PDR5 is induced upon pathogen infiltration. P. nicotianae (Pn), R. solani (Rs), F. oxysporum (Fo) or B. cinerea (Bc) were infiltrated into N. tabacum leaves using a syringe. Expression of ABCG5/PDR5 was followed by immunoblotting after 48 h (Pn, Rs and Fo) or 96 h (Bc) of infection using an ABCG5/PDR5-specific antibody and a general anti-H+-ATPase antibody as a loading control.

Download figure to PowerPoint

Silencing of ABCG5/PDR5

To determine the physiological role of ABCG5/PDR5, we restricted ABCG5/PDR5 expression by expressing an artificial micro RNA (amiRNA) (Schwab et al., 2006) directed against a specific region in ABCG5/PDR5. Two amiRNA constructs, driven by the constitutive En2pPMA4 promoter (De Muynck et al., 2009), were introduced into N. tabacum, and efficiently silenced lines were selected by immunoblotting of root tissues. Only one of the amiRNA constructs, amiRNA3, resulted in efficient silencing of ABCG5/PDR5 protein expression. Fourteen independent silenced plant lines were obtained. Figure 7(a) shows the results for the two lines, pdr5-1 and pdr5-2, that were chosen for further studies. The efficiency of silencing was checked regularly. In addition, we investigated whether silencing of ABCG5/PDR5 affected the protein expression of PDR1, another PDR gene expressed in roots. The PDR1 expression level was comparable in pdr5-1, pdr5-2 and wild-type plants (Figure S7).

image

Figure 7.  Silencing of ABCG5/PDR5 slightly increases susceptibility of N. tabacum to F. oxysporum. (a) ABCG5/PDR5 expression was silenced using an amiRNA construct directed against a specific region in ABCG5/PDR5 (see Experimental procedures). Microsomal fractions of hydroponically grown N. tabacum roots were isolated and subjected to immunoblotting using an ABCG5/PDR5-specific antibody and a general anti-H+-ATPase antibody as a loading control. Two independent lines, pdr5-1 and pdr5-2, showing efficient silencing, were selected. (b) Mortality of ABCG5/PDR5- and NpPDR1-silenced plants in N. tabacum 26 days after F. oxysporum infection. (c) Difference in leaf width of wild-type and ABCG5/PDR5-silenced plants 20 days after F. oxysporum infection. Standard deviations are shown. Asterisks indicate statistically significant differences compared with wild-type [*< 0.05, Tukey’s (HSD) test].

Download figure to PowerPoint

Silencing of ABCG5/PDR5 slightly increases the susceptibility of N. tabacum to F. oxysporum

As expression of ABCG5/PDR5 is induced upon pathogen infiltration, we investigated its role in plant defense and compared it to that of NpPDR1. NpPDR1-silenced lines of N. plumbaginifolia were more sensitive than wild-type to F. oxysporum, R. solani, P. nicotianae and B. cinerea in a root susceptibility test; total death of the inoculated plants was usually observed (Bultreys et al., 2009). We obtained an NpPDR1-silenced line of N. tabacum (Figure S8), and investigated whether the same effects were observed. In this case, total mortality was observed with F. oxysporum (Figure 7b).

Comparison of susceptibility of the ABCG5/PDR5- and NpPDR1-silenced plants against F. oxysporum indicated that silencing of ABCG5/PDR5 had a lower influence on plant resistance than silencing of NpPDR1. Whereas all the NpPDR1-silenced plants were killed, only one plant of 24 was killed in one ABCG5/PDR5-silenced line, and none in the other silenced line or the wild-type (Figure 7b).

As silencing of ABCG5/PDR5 does not show major effects on the susceptibility of N. tabacum plants towards F. oxysporum, we developed a test to detect weak effects in plant defense that consisted of measuring the leaf width 20 days after inoculation (Figure 7c). Under these conditions, ABCG5/PDR5-silenced plants displayed a low but significant increase in susceptibility, indicating a role of ABCG5/PDR5 in plant defense.

ABCG5/PDR5 expression is induced by the specialist herbivore Manduca sexta

As expression of ABCG5/PDR5 is induced after wounding and treatment with MeJA, we examined whether the presence of insects also has an effect on ABCG5/PDR5 expression in leaves. M. sexta is used as a model organism for studying plant–herbivore interactions (Steppuhn et al., 2004). Oral secretions from larvae are commonly used as an elicitor to mimic insect feeding on plants (Alborn et al., 1997, 2003). In order to be able to distinguish ABCG5/PDR5 expression induced by wounding as a result of chewing from the induction as a specific response to M. sexta larva oral secretions, we infiltrated leaves with water or oral secretions through the stomata, prepared a microsomal fraction 16 h after infiltration, and performed immunoblotting. As shown in Figure 8(a), the presence of oral secretions significantly increased ABCG5/PDR5 expression in leaves, suggesting its involvement in the response to herbivory.

image

Figure 8.  Induction of ABCG5/PDR5 expression by Manduca sexta oral secretions and Manduca sexta feeding. (a) Immunoblotting of microsomal fractions of leaves infiltrated with water (Water) or an equal volume of water and M. sexta oral secretions (OS) through the stomata using a syringe, or a non-treated area of the same leaf (Same leaf). The samples were probed using an ABCG5/PDR5-specific antibody or a general anti-H+-ATPase antibody as a loading control. (b) Immunoblotting of leaf microsomal fractions taken from the area surrounding the chewed part of the leaf after browsing by M. sexta for 24 h (Herbivored) and a non-chewed area of the same leaf as a control (Non-herbivored) using the same antibodies as in (a). (c,d) Leaf in situ GUS activity of plants carrying the ProPDR5:GV fusion construct that were not subjected to herbivory (c) and after M. sexta herbivory for 24 h (d). Arrows indicate the non-herbivored (c) and herbivored (d) leaf areas. Scale bars = 0.5 mm.

Download figure to PowerPoint

To examine whether ABCG5/PDR5 expression was induced after caterpillar feeding, we placed 4-day-old caterpillars on wild-type N. tabacum plants for 24 h, and performed immunoblotting on microsomal fractions from chewed areas and non-chewed areas of the same leaf. ABCG5/PDR5 expression was induced in the area around the feeding site but not at a distant site on the same leaf (Figure 8b).

Furthermore, ProPDR5:GV plants were used to visualize ABCG5/PDR5 promoter activity following herbivory. Four-day-old caterpillars were placed on leaves of transgenic N. tabacum plants for 24 h, then samples were taken from the feeding site and a non-injured area for GUS staining. GUS staining was hardly visible in the control samples (Figure 8c), but was intense at the site of herbivory (Figure 8d), confirming local induction of ABCG5/PDR5 expression upon caterpillar feeding.

Silencing of ABCG5/PDR5 favors herbivore performance

The performance of M. sexta larvae on ABCG5/PDR5-silenced plants was compared to that on wild-type plants in the glasshouse by weighing the larvae after 3, 6, 9 and 12 days of feeding. Larvae grown on the ABCG5/PDR5-silenced lines, pdr5-1 and pdr5-2, weighed significantly more than those grown on wild-type plants, with a weight difference of 31% between caterpillars grown on ABCG5/PDR5-silenced plants compared to wild-type after 12 days (Figure 9a). The increased mass gain correlated with more rapid development of the larvae grown on the silenced lines over the observation period (Figure 9b). For instance, on day 12, 19 and 27% of the caterpillars on the pdr5-1 and pdr5-2 transgenic plants, respectively, had reached stage 5, but none of the caterpillars on wild-type plants had reached this molting stage.

image

Figure 9.  Silencing of ABCG5/PDR5 expression improves Manduca sexta growth and development. (a) Mean larval mass of M. sexta caterpillars fed on ABCG5/PDR5-silenced lines and wild-type plants for 3, 6, 9 or 12 days after hatching. Three caterpillars were placed on each plant (n = 15), and the mean was determined (first the mean of 3 caterpillars per plant was taken and then the mean of 15 plants per line); the bars represent the 95% confidence interval. Asterisks indicate statistically significant differences compared with wild-type (***< 0.001, **P < 0.01, *< 0.05, Student’s t-test). (b) Development of M. sexta on ABCG5/PDR5-silenced lines and wild-type plants during 12 days after hatching.

Download figure to PowerPoint

Metabolite analysis

We isolated secondary metabolites from perforated leaf tissue that had been treated with M. sexta oral secretions and from healthy plant tissue to determine whether the faster development and decreased feeding restriction of M. sexta larvae on ABCG5/PDR5-silenced lines were due to a difference in the abundance of major anti-herbivore compounds. We used M. sexta oral secretions to mimic the presence of the caterpillar, as they contain chemicals that trigger the plant defense mechanism, including production of secondary metabolites that restrict caterpillar feeding. However, although a lower content of chlorogenic acid was observed in the two silenced lines compared to wild-type, neither the content of this metabolite nor that of nicotine, dicaffeoyl spermidine or rutin was significantly different from wild-type (Figure S9).

Alternatively, ABCG5/PDR5 may be involved in the plant-wide reallocation of carbohydrates from damaged tissue to other tissues in the plant (Meyer et al., 2004; Schwachtje and Baldwin, 2008). Concentrations of glucose, sucrose and fructose moieties were measured but did not vary significantly between wild-type and ABCG5/PDR5-silenced lines (Figure S10).

Discussion

  1. Top of page
  2. Summary
  3. Introduction
  4. Results
  5. Discussion
  6. Experimental procedures
  7. Acknowledgments
  8. References
  9. Supporting Information

In this study, we cloned a full-length ABC transporter sequence, ABCG5/PDR5, that clusters in sub-group III of the PDR transporter sub-family (Figure S1). Using ProPDR5:GUS analysis and immunoblotting, we showed that, under standard growth conditions, ABCG5/PDR5 expression was constitutively high in roots, stems and flowers, but marginal in leaves (Figure 2). In agreement with the presence of a T/G box motif in the promoter region of ABCG5/PDR5, which has been shown to be involved in MeJA and wounding responses (Guerineau et al., 2003; Boter et al., 2004; Delessert et al., 2004), ABCG5/PDR5 expression was induced in leaves upon treatment with MeJA and wounding (Figures 4 and 5). Exogenous application of MeJA causes induction of various plant defense-related proteins (Repka et al., 2001), which suggests an involvement of ABCG5/PDR5 in the response to biotic stress.

The plant biotic stress response involves several defense mechanisms that allow the plant to cope with the challenges of the living environment. Accumulation of plant secondary metabolites and inhibitory proteins restricts pathogen invasion and insect feeding. Increasing evidence suggests that full-size ABC transporters of the ABCG/PDR sub-family mediate the secretion of plant defense compounds into the apoplast, onto the plant surface, or into the rhizosphere (Kretzschmar et al., 2011). N. plumbaginifolia plants that are silenced for the expression of NpPDR1 show spontaneous infections and are highly susceptible to controlled fungal infections (Stukkens et al., 2005; Bultreys et al., 2009). Similarly, PDR transporters from Arabidopsis, AtABCG36/AtPDR8, and wheat, LR34, were found to function in pathogen resistance (Kobae et al., 2006; Stein et al., 2006; Krattinger et al., 2009). NpPDR1 is thought to transport the anti-microbial secondary metabolite sclareol onto the leaf surface to restrict pathogen proliferation. The substrates of AtABCG36/AtPDR8 and LR34 in the context of pathogen defense are not known.

On the basis of these reports, we investigated the expression of ABCG5/PDR5 in the presence of fungal pathogens, and showed that expression was induced after infiltration with fungal pathogens (Figure 6). However, when ABCG5/PDR5-silenced lines of N. tabacum were inoculated with various fungal pathogens, including F. oxysporum, there was only a marginal difference in sensitivity compared to infected wild-type plants (Figure 7b,c). In contrast, N. tabacum plants silenced for NpPDR1 were heavily infected in the presence of F. oxysporum, comparable to the infections observed on N. plumbaginifolia plants silenced for the same gene (Bultreys et al., 2009). This may indicate that ABCG5/PDR5 does not play a prominent role in defense against F. oxysporum, but it is also possible that its role is masked by the presence of other important players in the defense mechanism that compensate for the decrease in ABCG5/PDR5 protein levels.

Recently, it was suggested that ABCG/PDR transporters may play a role in defense against herbivores, as they are involved in the secondary metabolite-based pathogen response (Kretzschmar et al., 2011), but there is currently no experimental evidence for this. Here, we showed that ABCG5/PDR5 expression was induced locally in leaves by M. sexta oral secretions and herbivory, indicating a role in the defense response (Figure 8). Expression was seen in close proximity to the physical damage and not in untreated areas of the same leaf. Interestingly, silencing of ABCG5/PDR5 rendered N. tabacum plants more susceptible to feeding by M. sexta (Figure 9a), suggesting that this diet was more appealing than wild-type leaves. In addition, M. sexta larvae developed faster on ABCG5/PDR5-silenced lines compared to those fed on wild-type plants (Figure 9b). These data provide experimental evidence for the involvement of a PDR transporter in the response to herbivory.

Damage by herbivory induces the production of compounds that limit feeding and protect against further pathogen invasions (Delessert et al., 2004). We analyzed the major anti-herbivore compounds nicotine, chlorogenic acid, dicaffeoyl spermidine and rutin, but did not observe any significant difference between wild-type and ABCG5/PDR5-silenced plants (Figure S9). At this stage, we cannot exclude the possibility that another metabolite important in herbivore repellence is affected in the ABCG5/PDR5-silenced lines. A thorough study of a wide range of secondary metabolites may answer this question.

In addition, plants respond to herbivore attacks by reallocating carbohydrate resources from the damaged tissue (Meyer et al., 2004; Schwachtje and Baldwin, 2008). ABCG5/PDR5 may be involved in the transport of carbohydrates from damaged tissue to other tissues in the plant. As we did not observe any significant difference in the concentration of glucose, sucrose or fructose in the ABCG5/PDR5-silenced plants compared to wild-type (Figure S10), the improved caterpillar performance cannot be attributed to altered carbohydrate transport by ABCG5/PDR5 within damaged tissue.

ABCG5/PDR5 expression was induced in N. tabacum leaves following physical damage, and was maintained for at least 72 h after wounding (Figure 5b,c). This may indicate that the protein is involved in a defense response in tissues on which the caterpillar fed earlier and moved away from. In this case, the importance of ABCG5/PDR5 may not be in limiting actual feeding, but in limiting continuous feeding on injured tissue or in wound healing.

Attack by insects triggers the expression of genes involved in herbivore deterrence and also in wound healing and other defense-related processes (Karban and Baldwin, 1997). Whereas systemically induced genes are thought to play a role in driving the defense mechanism to prevent further herbivore or pathogen attacks, locally induced genes are predicted to function in wound healing and repair, and in protecting the wound from water loss and further attacks (Delessert et al., 2004). Abscisic acid (ABA), a hormone that is involved in the response to water stress, accumulates in close proximity to the wound site and is thought to play a role in maintaining the physiological state of the plant (Birkenmeier and Ryan, 1998). Several PDR transporters have been shown to either directly transport ABA or be part of the ABA signaling cascade (Kanai et al., 2010; Kang et al., 2010; Kuromori et al., 2010, 2011). The possible involvement of ABC transporters in ABA transport or accumulation after wounding has not been investigated, but represents an interesting field for further investigation.

Wound healing also involves the accumulation of waxes and repair of the cuticle at the wound site. The involvement of PDR transporters in formation of the cuticle layer has been reported recently. Disruption of ABCG32/PEC1 in Arabidopsis has a significant impact on the formation of the cuticle (Bessire et al., 2011). Furthermore, HvABCG31 has been reported to be important in leaf water retention due to a physiological function in cutin deposition (Chen et al., 2011). The cuticle acts as the first barrier against pathogens and herbivores, meaning that resistance starts here. Little is known about the role of the plant cuticle in the induced defense against herbivores. However, it is possible that induced defense mechanisms act by production of waxes or biosynthesis of secondary metabolites that are deposited on the plant cuticle after herbivore attack and serve as a deterrent to, or are toxic for, the attacker (Müller, 2008). The potential involvement of ABCG5/PDR5 in fatty acid transport or the deposition of secondary metabolites onto the wounded leaf area remains to be investigated.

In addition to its induction by herbivores in leaf tissues, ABCG5/PDR5 expression is constitutively found in other tissues, including roots and stems. In roots, the transporter may function in the extrusion of secondary metabolites into the rhizosphere to defeat soil-borne pathogens or communicate with the microbial community. In stems, the function may consist in defeating pathogens such as fungi that move along the vascular tissue from the roots to the aerial part of the plant. The substrate of ABCG5/PDR5 in these tissues may be similar or very different from that in leaves. Whereas some ABCB transporters have been shown to have high substrate specificity (Knöller et al., 2010; Bailly et al., 2011), other ABC transporters are able to transport various substrates with unrelated structures. For instance, AtABCG36/AtPDR8 is thought to extrude cadmium (Kim et al., 2007) and indole-3-butyric acid (Strader and Bartel, 2009) from roots. In which form these molecules are transported by AtABCG36/AtPDR8 is unknown, but this may indicate that this PDR transporter has a broad substrate spectrum. For the mouse P-glycoprotein, an ABC transporter for which a 3D structure has been elucidated, this pleiotropy is explained by multiple binding sites in a large internal cavity that may accommodate several substrates (Aller et al., 2009). Addressing the question as to whether ABCG5/PDR5 also has multiple substrates and functions will require further work.

In conclusion, we present evidence that silencing of ABCG5/PDR5 renders N. tabacum plants more susceptible to M. sexta feeding. ABCG5/PDR5 expression is highly responsive to wounding and herbivory, and is induced only in close proximity to the site of physical damage. The observation that PDR transporters are involved in the defense response to herbivory opens up a new dimension in terms of the importance of this protein family in plants.

Experimental procedures

  1. Top of page
  2. Summary
  3. Introduction
  4. Results
  5. Discussion
  6. Experimental procedures
  7. Acknowledgments
  8. References
  9. Supporting Information

Plant growth

Nicotiana tabacum cv. Petit Havana SR1 (Maliga et al., 1973), Nicotiana tomentosiformis and Nicotiana sylvestris (Institut du Tabac, Bergerac, France) were grown on soil in a climate chamber under 12 h light (200 μmol photons m−2 sec−1) at 25°C and 12 h dark at 23°C.

For in vitro growth, seeds were sterilized for 20 min in 50% v/v commercial bleach. Seeds were vernalized at 4°C for 48 h prior to germination.

Selection of transgenic plants was performed on Murashige and Skoog medium [4.4 g l−1 MS salts (MP Biomedicals, http://www.mpbio.com/), pH 5.8 (KOH), 3% sucrose, 0.9% agar] supplemented with 100 μm kanamycin. In vitro cultures were grown at 25°C under a photoperiod of 16 h light (50 μmol photons m−2 sec−1)/8 h dark. T2 generations were used in all experiments described.

For analyses of root material, plants were grown in in vitro culture on MS medium, then transferred to hydroponic solution (1.25 mm Ca(NO)3, 1.25 mm MgSO4, 1.25 mm KNO3, 0.25 mm KH2PO4, 25 μm Fe(III)Na2EDTA, 12.5 μm H3BO3, 11.25 μm MnCl2, 9.5 μm ZnSO4, 0.75 μm CuSO4, 0.25 μm (NH4)6Mo7O24).

Gene cloning

The full-length NpABCG5/PDR5 sequence (accession number JQ808000) was obtained from root cDNA of N. plumbaginifolia by RACE PCR using degenerate primers. RNA was prepared using the Trizol method (Sigma, http://sigmaaldrich.com/) followed by DNase treatment (Roche, http://www.roche.com/) prior to cDNA synthesis. Full-length NpABCG5/PDR5 was amplified using forward primer 5′-ATGGAGGCAAATGGGGGACCG-3′ and reverse primer 5′-CTATCTAGTTTGGAAGTTCAATGTCTTGATAGC-3′, and cloned into the pGEM-T easy cloning vector (Promega, http://www.promega.com/).

NtABCG5/PDR5 was amplified from root cDNA of N. tabacum using a forward primer designed according to the homology of NpABCG5/PDR5 with an EST clone on the Gene Index Project website (http://compbio.dfci.harvard.edu/tgi/plant.html) (5′-GTGAAAATGGAGGGAAATG-3′) and the NpABCG5/PDR5 reverse primer (5′-CTATCTAGTTTGGAAGTTCAATGTC-3′). Two sequences corresponding to NtABCG5/PDR5 [accession numbers JQ808002 (a) and JQ808003 (b)] were identified.

ABCG5/PDR5 promoter–GUSVENUS fusion

To clone the NpABCG5/PDR5 promoter region (accession number JQ808001), 10 μg of N. plumbaginifolia genomic DNA was digested with several restriction enzymes and purified, then the linearized DNA was self-ligated. Inverted PCR reactions were performed on circularized DNA using specific primers. A fragment of 1482 bp upstream of the start codon was obtained and amplified using the forward primer 5′-GTACAGAGGATAATGTTATTCAA-3′ and reverse primer 5′-AAGCTTTCACAATAATCTCTTAT-3′. The NpABCG5/PDR5 promoter was inserted in front of the GUSVENUS (GV) coding sequence in pAUX3131 (Navarre et al., 2011) using NotI and HindIII sites, then the fusion construct was excised using I-SceI and inserted into the pPZP-RCS2-nptII plant expression vector (Goderis et al., 2002). The constructs were introduced into Agrobacterium tumefaciens (LBA4404 virGN54D; van der Fits et al., 2000) for subsequent N. tabacum leaf disk transformation (Horsch et al., 1986).

GUS activity

Various N. tabacum plant tissues were fixed and stained for GUS activity as described by Moriau et al. (1999). For GUS quantification, microsomal membrane fractions were isolated as described below. The supernatant containing the soluble proteins was used for an activity assay performed as described by Navarre et al. (2011).

ABCG5/PDR5–GFP fusions and plasma membrane localization

NpABCG5/PDR5 was cloned into pAUX3131 between the tNOS terminator and the constitutive NpPMA4 promoter fused to two copies of the same enhancer (En2pPMA4) (De Muynck et al., 2009). GFP (mgfp4) (Haseloff et al., 1997) was amplified by PCR using forward primer 5′-AATCCGCGGAAAATGAGTAAAGGAGAA-3′ and reverse primer 5′-CTTCCGCGGCCACCTCCTCCTTTGTATAGTTCATCCAT-3′, and fused at the N-terminus of the NpABCG5/PDR5 coding sequence at the SacI site. For the C-terminal fusion of GFP, the stop codon of ABCG5/PDR5 was removed by PCR using forward primer 5′-TGACTCGAGTTCTTGAAACTTGT-3′ and reverse primer 5′-TTTCCTAGGTCTAGTTTGGAAGTTCA-3′, and the original sequence was replaced using XhoI and AvrII (NEB, http://www.neb-online.de/). The GFP coding sequence was ligated in-frame with the ABCG5/PDR5 coding sequence after amplification with forward primer 5′-AAACTCGAGACCTAGGGGAGGAGGTGGCGGAATGAGTAAAGGAGA-3′ and reverse primer 5′-TTGGATCCTTATTTGTATAGTTCATCC-3′ using XhoI and BamHI.

The fusion constructs were excised from pAUX3131 using I-SceI and inserted into pPZP-RCS2-nptII. Markers for the tonoplast (AtTIP2;1–YFP) or the ER (CFP–HDEL) were co-expressed with GFP–PDR5. After transformation of A. tumefaciens, the constructs were transiently expressed in N. tabacum or N. benthamiana leaves, and fluorescence was examined after 3 days of expression using a LSM 710 confocal microscope (Zeiss, http://microscopy.zeiss.com/microscopy/). FM4-64 (50 μm; Invitrogen, http://www.invitrogen.com/), a plasma membrane marker, was infiltrated into the transformed leaves shortly before examination. GFP, CFP and YFP were excited using the 488, 405 and 514 nm laser lines of an argon multi-laser, respectively. The emitted light was detected at 419–515 nm (GFP) and 519–566 nm (YFP) for GFP–PDR/TIP2;1–YFP co-localization, and 494–550 nm (GFP) and 434–495 nm (CFP) for GFP–PDR/CFP–HDEL co-localization. FM4-64 was excited using the 514 nm line of an argon multi-laser and the emitted light was detected at 640–758 nm.

Isolation of the microsomal fraction

All steps were performed at 4°C. Plant tissues (approximately 150 mg) were homogenized in 800 μl of 250 mm sorbitol, 60 mm Tris, 2 mm Na2EDTA, 10 mm dithiothreitol, 0.7% polyvinylpolypyrrolidone (Polyclar AT; Serva, http://www.serva.de/), 1 mm phenylmethanesulfonyl fluoride and a peptidase inhibitor cocktail (1 μg ml−1 each of leupeptin, pepstatin, aprotinin, antipain and chymostatin) at pH 8 (HCl), and the homogenate was centrifuged at 2700 g for 10 min. The supernatant was then centrifuged for 10 min at 3800 g and at 100 000 g for 15 min. The final pellet was suspended in 5 mm KH2PO4, 330 mm sucrose, 3 mm KCl, 10 mm phenylmethanesulfonyl fluoride and 1 μg ml−1 peptidase inhibitor cocktail, pH 7.8. Protein was quantified using the Bradford method (Bradford et al., 1976).

Immunoblotting

Microsomal fractions (20 μg) were separated by SDS–PAGE (8% or 12% polyacrylamide) and electroblotted onto poly(vinylidene difluoride) membranes (Millipore, http://www.millipore.com/). A rabbit ABCG5/PDR5-specific antibody was generated against the peptide QASDMEADQEESTGSPRLRISQSKRDDLPRSLSAADGNKTREMEIRRMSSRTSSS-GFYRNE. Antibodies were diluted as follows: anti-ABCG5/PDR5 antibody, 1:1000; anti-Nt-TIPa antibody (Gerbeau et al., 1999), 1:1000; anti-PDR1 antibody, 1:1000; anti-H+-ATPase antibody (Morsomme et al., 1998), 1:500 000; horseradish peroxidase-labeled goat anti-rabbit IgG antibodies (Biognost, http://www.biognost.be/), 1:10 000.

Plasma membrane purification

All steps were performed at 4°C. Hydroponically grown N. tabacum roots (25 g) were ground in 250 mm sorbitol, 60 mm Tris, 2 mm Na2EDTA, 0.6% polyvinylpolypyrrolidone, 20 mm dithiothreitol, 1 μg ml−1 of peptidase inhibitor cocktail and 1 mm phenylmethanesulfonyl fluoride in a blender. The homogenate was filtered through four layers of Miracloth (Calbiochem, http://www.calbiochem.com/), and centrifuged for 5 min at 10 000 g, then the supernatant was centrifuged for 30 min at 100 000 g. The resultant microsomal fraction was homogenized in 700 μl of 5 mm KH2PO4, 330 mm sucrose, 3 mm KCl at pH 7.8 (KOH). Plasma membranes were purified by partitioning in an aqueous two-phase system as described by Larsson et al. (1987).

Silencing of NtABCG5/PDR5

Silencing of NtABCG5/PDR5 in N. tabacum was performed using the artificial microRNA technique (Schwab et al., 2006). Two constructs were created as described at http://wmd3.weigelworld.org/. The hairpin construct was amplified using the primers described in Figure S11, and cloned downstream of the En2ProPMA4 promoter in pAUX3131 using KpnI and SacI. The expression cassette was then excised using I-SceI and inserted into pPZP-RCS2-nptII, and the constructs were transformed into A. tumefaciens (LBA4404) for subsequent N. tabacum leaf disk transformation (Horsch et al., 1986).

Pathogen susceptibility assay

An NpPDR1-silenced line of N. tabacum was obtained by introducing the small hairpin construct, previously used for N. plumbaginifolia, by A. tumefaciens-mediated transformation (Stukkens et al., 2005). Efficient silencing was confirmed by immunoblotting (Figure S5).

Wild-type and NpPDR1-silenced lines were compared in a root sensitivity test based on plant mortality in response to infection with the pathogen F. oxysporum (PB1). F. oxysporum PB1 was isolated in Belgium from a naturally infected N. plumbaginifolia NpPDR1-silenced plant; it was identified at the species level on the basis of morphological characteristics. Susceptibility toward F. oxysporum of NpPDR1- and ABCG5/PDR5-silenced lines was compared as described previously (Bultreys et al., 2009).

Differences in plant resistance between wild-type and ABCG5/PDR5-silenced lines were measured on homogeneous plantlets grown in glasshouses and maintained with sterilized water. Growth measurements (leaf width) were performed on the widest new leaf that appeared after 20 days of infection. The leaf width of each inoculated plant was subtracted from the mean leaf width of the non-inoculated plants.

Secondary metabolite analysis

Samples for secondary metabolite analysis were obtained from non-herbivorized stem leaves as a control, or from leaves that were wounded using a metal fabric pattern wheel followed by immediate application of M. sexta oral secretions. Samples were collected 72 h after elicitation. Leaf tissue samples were flash-frozen in liquid nitrogen and stored at −80°C until extraction. The method for secondary metabolite extraction was adapted from Keinänen et al. (2001), and the method for analysis by HPLC was adapted from Jassbi et al. (2008) and Kaur et al. (2010).

Sugar analysis

Frozen leaf extracts were homogenized, and 100 mg tissue was suspended in 500 μl of 80% v/v ethanol/water; the mixture was incubated for 10 min at 78°C. Samples were centrifuged at 20 800 g for 5 min at 4°C. The resulting supernatant was transferred and the pellet was re-dissolved in 500 μl of 50% v/v ethanol, and sugars were extracted as above. Both supernatants were pooled for final analysis. The concentrations of the soluble sugars sucrose, fructose and glucose were determined in this order by the coupled enzymatic assay described by Jones et al. (1997), using a 96-well microplate photometer (Infinite Pro 200; Tecan, http://www.tecan.com/).

M. sexta growth and development assay

Manduca sexta eggs from in-house reared populations were kept in a growth chamber (Snijders Scientific, http://www.snijders-scientific.nl/) at 26°C for 16 h light and at 24°C for 8 h of darkness until the larvae hatched. Three freshly hatched M. sexta neonates per plant were placed on separate leaves of 15 replicate elongating N. tabacum plants, and larval mass was measured after 3, 6, 9 and 12 days of herbivory.

Acknowledgments

  1. Top of page
  2. Summary
  3. Introduction
  4. Results
  5. Discussion
  6. Experimental procedures
  7. Acknowledgments
  8. References
  9. Supporting Information

This work was supported by the Interuniversity Poles of Attraction Program (Belgian State, Scientific, Technical, and Cultural Services), the Belgian National Fund for Scientific Research, the Walloon Agricultural Research Centre, and grants D31-1132/S2 and D31-1174/S2 from the Ministry of the Walloon Region, Head Office of Agriculture. The authors thank Joseph Nader, Sébastien Lievyns, Abdelmounaim Errachid and Nicolas Noël for technical help, Hagen Reinhardt and Adrien Chevalier for providing the TIP–YFP and CFP–HDEL constructs, respectively, Danny Kessler for supplying the Manduca sexta larvae, and Viviane Planchon (Department of Agriculture and Natural Environment, Centre Wallon de Recherches Agronomiques) for help with development and statistical analysis of fungal pathogenicity tests.

References

  1. Top of page
  2. Summary
  3. Introduction
  4. Results
  5. Discussion
  6. Experimental procedures
  7. Acknowledgments
  8. References
  9. Supporting Information
  • Alborn, T., Turlings, T.C.J., Jones, T.H., Stenhagen, G., Loughrin, J.H. and Tumlinson, J.H. (1997) An elicitor of plant volatiles from beet armyworm oral secretion. Science, 276, 945949.
  • Alborn, H.T., Brennan, M.M. and Tumlinson, J.H. (2003) Differential activity and degradation of plant volatile elicitors in regurgitant of tobacco hornworm (Manduca sexta) larvae. J. Chem. Ecol.29, 13571372.
  • Aller, S.G., Yu, J., Ward, A. et al. (2009) Structure of P-glycoprotein reveals a molecular basis for poly specific drug binding. Science, 323, 17181722.
  • Allmann, S. and Baldwin, I.T. (2010) Insects betray themselves in nature to predators by rapid isomerization of green leaf volatiles. Science, 329, 10751078.
  • Arimura, G., Kost, C. and Boland, W. (2005) Herbivore-induced, indirect plant defences. Biochim. Biophys. Acta, 1734, 91111.
  • Bailly, A., Yang, H., Martinoia, E., Geisler, M. and Murphy, A.S. (2011) Plant lessons: exploring ABCB functionality through structural modeling. Front. Plant Sci.2, 108.
  • Baldwin, I.T., Halitschke, R., Kessler, A. and Schittko, U. (2001) Merging molecular and ecological approaches in plant–insect interactions. Curr. Opin. Plant Biol.4, 351358.
  • Bessire, M., Borel, S., Fabre, G. et al. (2011) A member of the PLEIOTROPIC DRUG RESISTANCE family of ATP binding cassette transporters is required for the formation of a functional cuticle in Arabidopsis. Plant Cell, 23, 19581970.
  • Birkenmeier, G.F. and Ryan, C.A. (1998) Wound signaling in tomato plants. Evidence that ABA is not a primary signal for defense gene activation. Plant Physiol.117, 687693.
  • Bisgrove, S.R., Simonich, M.T., Smith, N.M., Sattler, A. and Innes, R.W. (1994) A disease resistance gene in Arabidopsis with specificity for two different pathogen avirulence genes. Plant Cell, 6, 927933.
  • Boter, M., Ruíz-Rivero, O., Abdeen, A. and Prat, S. (2004) Conserved MYC transcription factors play a key role in jasmonate signaling both in tomato and Arabidopsis. Genes Dev.18, 15771591.
  • Boutry, M. and Chua, N.H. (1985) A nuclear gene encoding the beta subunit of the mitochondrial ATP synthase in Nicotiana plumbaginifolia. EMBO J.4, 21592165.
  • Bradford, M.M. (1976) A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding. Anal. Biochem.72, 248254.
  • Bultreys, A., Trombik, T., Drozak, A. and Boutry, M. (2009) Nicotiana plumbaginifolia plants silenced for the ATP-binding cassette transporter gene NpPDR1 show increased susceptibility to a group of fungal and oomycete pathogens. Mol. Plant Pathol.10, 651663.
  • Chen, G., Komatsuda, T., Ma, J.F. et al. (2011) An ATP-binding cassette subfamily G full transporter is essential for the retention of leaf water in both wild barley and rice. Proc. Natl Acad. Sci. USA, 108, 1235412359.
  • Creelman, R.A. and Mullet, J.E. (1997) Biosynthesis and action of jasmonates in plants. Annu. Rev. Plant Physiol. Plant Mol. Biol.48, 355381.
  • van Dam, N.M., Horn, M., Mares, M. and Baldwin, I.T. (2001) Ontogeny constrains systemic protease inhibitor response in Nicotiana attenuata. J. Chem. Ecol.27, 547568.
  • De Muynck, B., Navarre, C., Nizet, Y., Stadlmann, J. and Boutry, M. (2009) Different subcellular localization and glycosylation for a functional antibody expressed in Nicotiana tabacum plants and suspension cells. Transgenic Res.18, 467482.
  • Delessert, C., Wilson, I.W., Van Der Straeten, D., Dennis, E.S. and Dolferus, R. (2004) Spatial and temporal analysis of the local response to wounding in Arabidopsis leaves. Plant Mol. Biol.55, 165181.
  • van der Fits, L., Deakin, E.A., Hoge, J.H.C. and Memelink, J. (2000) The ternary transformation system: constitutive virG on a compatible plasmid dramatically increases Agrobacterium-mediated plant transformation. Plant Mol. Biol.43, 495502.
  • Gerbeau, P., Güçlü, J., Ripoche, P. and Maurel, C. (1999) Aquaporin Nt-TIPa can account for the high permeability of tobacco cell vacuolar membrane to small neutral solutes. Plant J.18, 577587.
  • Goderis, I.J., De Bolle, M.F., Francois, I.E., Wouters, P.F., Broekaert, W.F. and Cammue, B.P. (2002) A set of modular plant transformation vectors allowing flexible insertion of up to six expression units. Plant Mol. Biol.50, 1727.
  • Guerineau, F., Benjdia, M. and Zhou, D.X. (2003) A jasmonate-responsive element within the A. thaliana vsp1 promoter. J. Exp. Bot.54, 11531162.
  • Haseloff, J., Siemering, K.R., Prasher, D.C. and Hodge, S. (1997) Removal of a cryptic intron and subcellular localization of green fluorescent protein are required to mark transgenic Arabidopsis plants brightly. Proc. Natl Acad. Sci. USA, 94, 21222127.
  • Heiling, S., Schuman, M.C., Schoettner, M., Mukerjee, P., Berger, B., Schneider, B., Jassbi, A.R. and Baldwin, I.T. (2010) Jasmonate and ppHsystemin regulate key malonylation steps in the biosynthesis of 17-hydroxygeranyllinalool diterpene glycosides, an abundant and effective direct defense against herbivores in Nicotiana attenuata. Plant Cell, 22, 273292.
  • Horsch, R.B., Klee, H.J., Stachel, S., Winans, S.C., Nester, E.W., Rogers, S.G. and Fraley, R.T. (1986) Analysis of Agrobacterium tumefaciens virulence mutants in leaf discs. Proc. Natl Acad. Sci. USA, 83, 25712575.
  • Hui, D.Q., Iqbal, J., Lehmann, K., Gase, K., Saluz, H.P. and Baldwin, I.T. (2003) Molecular interactions between the specialist herbivore Manduca sexta (Lepidoptera, Sphingidae) and its natural host Nicotiana attenuata. V. Microarray analysis and further characterization of large-scale changes in herbivore-induced mRNAs. Plant Physiol.131, 18771893.
  • Ito, H. and Gray, W.M. (2006) A gain-of-function mutation in the Arabidopsis pleiotropic drug resistance transporter PDR9 confers resistance to auxinic herbicides. Plant Physiol.142, 6374.
  • Jasinski, M., Stukkens, Y., Degand, H., Purnelle, B., Marchand-Brynaert, J. and Boutry, M. (2001) A plant plasma membrane ATP binding cassette-type transporter is involved in antifungal terpenoid secretion. Plant Cell, 13, 10951107.
  • Jassbi, A.R., Gase, K., Hettenhausen, C., Schmidt, A. and Baldwin, I.T. (2008) Silencing geranylgeranyl diphosphate synthase in Nicotiana attenuata dramatically impairs resistance to tobacco hornworm. Plant Physiol.146, 974986.
  • Jones, M.G.K., Outlaw, W.H. and Lowry, O.H. (1977) Enzymatic assay of 10−7 to 10−4 moles of sucrose in plant tissues. Plant Physiol.60, 379383.
  • Johnson, E.S., Wolff, M.F., Wernsman, E.A., Atchley, W.R. and Shew, H.D. (2002) Origin of the black shank resistance gene, Ph, in tobacco cultivar Coker 371-Gold. Plant Dis.86, 10801084.
  • Kanai, M., Nishimura, M. and Hayashi, M. (2010) A peroxisomal ABC transporter promotes seed germination by inducing pectin degradation under the control of ABI5. Plant J.62, 936947.
  • Kang, J., Hwang, J.U., Lee, M., Kim, Y.Y., Assmann, S.M., Martinoia, E. and Lee, Y. (2010) PDR-type ABC transporter mediates cellular uptake of the phytohormone abscisic acid. Proc. Natl Acad. Sci. USA, 107, 23552360.
  • Kang, J., Park, J., Choi, H., Burla, B., Kretzschmar, T., Lee, Y. and Martinoia, E. (2011) Plant ABC transporters. Arabidopsis Book, 9, e0153. Doi: 10.1190/tab.0153
  • Karban, R. and Baldwin, I.T. (1997) Induced Responses to Herbivory. Chicago, IL: University of Chicago Press.
  • Karban, R., Baldwin, I.T., Baxter, K.J., Laue, G. and Felton, G.W. (2000) Communication between plants: induced resistance in wild tobacco plants following clipping of neighboring sagebrush. Oecologia, 125, 6671.
  • Kaur, H., Heinzel, N., Schöttner, M., Baldwin, I.T. and Gális, I. (2010) R2R3-NaMYB8 regulates the accumulation of phenylpropanoid–polyamine conjugates, which are essential for local and systemic defense against insect herbivores in Nicotiana attenuata. Plant Physiol.152, 17311747.
  • Keinänen, M., Oldham, N.J. and Baldwin, I.T. (2001) Rapid HPLC screening of jasmonate-induced increases in tobacco alkaloids, phenolics, and diterpene glycosides in Nicotiana attenuata. J. Agric. Food Chem.49, 35533558.
  • Kim, D.Y., Bovet, L., Maeshima, M., Martinoia, E. and Lee, Y. (2007) The ABC transporter AtPDR8 is a cadmium extrusion pump conferring heavy metal resistance. Plant J.50, 207218.
  • Kim, D.Y., Jin, J.Y., Alejandro, S., Martinoia, E. and Lee, Y. (2010) Overexpression of AtABCG36 improves drought and salt stress resistance in Arabidopsis. Physiol. Plant.139, 170180.
  • Knöller, A.S., Blakeslee, J.J., Richards, E.L., Peer, W.A. and Murphy, A.S. (2010) Brachytic2/ZmABCB1 functions in IAA export from intercalary meristems. J. Exp. Bot.61, 36893696.
  • Kobae, Y., Sekino, T., Yoshioka, H., Nakagawa, T., Martinoia, E. and Maeshima, M. (2006) Loss of AtPDR8, a plasma membrane ABC transporter of Arabidopsis thaliana, causes hypersensitive cell death upon pathogen infection. Plant Cell Physiol.47, 309318.
  • Kos, V. and Ford, R.C. (2009) The ATP-binding cassette family: a structural perspective. Cell. Mol. Life Sci.66, 31113126.
  • Krattinger, S.G., Lagudah, E.S., Spielmeyer, W., Singh, R.P., Huerta-Espino, J., McFadden, H., Bossolini, E., Selter, L.L. and Keller, B. (2009) A putative ABC transporter confers durable resistance to multiple fungal pathogens in wheat. Science, 323, 13601363.
  • Kretzschmar, T., Burla, B., Lee, Y., Martinoia, E. and Nagy, R. (2011) Functions of ABC transporters in plants. Essays Biochem.50, 145160.
  • Kretzschmar, T., Kohlen, W., Sasse, J., Borghi, L., Schlegel, M., Bachelier, J.B., Reinhardt, D., Bours, R., Bouwmeester, H.J. and Martinoia, E. (2012) A petunia ABC protein controls strigolactone-dependent symbiotic signalling and branching. Nature, 483, 341344.
  • Kuromori, T., Miyaji, T., Yabuuchi, H., Shimizu, H., Sugimoto, E., Kamiya, A., Moriyama, Y. and Shinozaki, K. (2010) ABC transporter AtABCG25 is involved in abscisic acid transport and responses. Proc. Natl Acad. Sci. USA, 107, 23612366.
  • Kuromori, T., Sugimoto, E. and Shinozaki, K. (2011) Arabidopsis mutants of AtABCG22, an ABC transporter gene, increase water transpiration and drought susceptibility. Plant J.67, 885894.
  • Larsson, C., Widell, S. and Kjellbom, P. (1987) Preparation of high-purity plasma membranes. Methods Enzymol.148, 558568.
  • Lee, M., Lee, K., Lee, J., Noh, E.W. and Lee, Y. (2005) AtPDR12 contributes to lead resistance in Arabidopsis. Plant Physiol.138, 827836.
  • Maliga, P., Sz-Breznovits, A. and Márton, L. (1973) Streptomycin-resistant plants from callus culture of haploid tobacco. Nat. New Biol.244, 2930.
  • Meyer, S., Lauterbach, C., Niedermeier, M., Barth, I., Sjolund, R.D. and Sauer, N. (2004) Wounding enhances expression of AtSUC3, a sucrose transporter from Arabidopsis sieve elements and sink tissues. Plant Physiol.134, 684693.
  • Moriau, L., Michelet, B., Bogaerts, P., Lambert, L., Michel, A., Oufattole, M. and Boutry, M. (1999) Expression analysis of two gene subfamilies encoding the plasma membrane H+-ATPase in Nicotiana plumbaginifolia reveals the major transport functions of this enzyme. Plant J.19, 3141.
  • Morsomme, P., Dambly, S., Maudoux, O. and Boutry, M. (1998) Single point mutations distributed in 10 soluble and membrane regions of the Nicotiana plumbaginifolia plasma membrane PMA2 H+-ATPase activate the enzyme and modify the structure of the C-terminal region. J. Biol. Chem.273, 3483734842.
  • Müller, C. (2008) Resistance at the plant cuticle. In Induced Plant Resistance to Herbivory (Schaller, A., eds). Dordrecht, The Netherlands: Springer, pp. 107129.
  • Navarre, C., Sallets, A., Gauthy, E., Maîtrejean, M., Magy, B., Nader, J., Pety de Thozée, C., Crouzet, J., Batoko, H. and Boutry, M. (2011) Isolation of heat shock-induced Nicotiana tabacum transcription promoters and their potential as a tool for plant research and biotechnology. Transgenic Res.20, 799810.
  • Repka, V., Fischerová, I. and Šilhárová, K. (2001) Methyl jasmonate induces a hypersensitive-like response of grapevine in the absence of avirulent pathogens. Vitis, 40, 510.
  • Ruocco, M., Ambrosino, P., Lanzuise, S., Woo, S.L., Lorito, M. and Scala, F. (2011) Four potato (Solanum tuberosum) ABCG transporters and their expression in response to abiotic factors and Phytophthora infestans infection. J. Plant Physiol.168, 22252233.
  • Ruzicka, K., Strader, L.C., Bailly, A. et al. (2010) Arabidopsis PIS1 encodes the ABCG37 transporter of auxinic compounds including the auxin precursor indole-3-butyric acid. Proc. Natl Acad. Sci. USA, 107, 1074910753.
  • Schwab, R., Ossowski, S., Riester, M., Warthmann, N. and Weigel, D. (2006) Highly specific gene silencing by artificial microRNAs in Arabidopsis. Plant Cell, 18, 11211133.
  • Schwachtje, J. and Baldwin, I.T. (2008) Why does herbivore attack reconfigure primary metabolism?Plant Physiol.146, 845851.
  • Seo, S., Gomi, K., Kaku, H. et al. (2012) Identification of natural diterpenes that inhibit bacterial wilt disease in tobacco, tomato and Arabidopsis. Plant Cell Physiol.53, 14321444.
  • Stein, M., Dittgen, J., Sánchez-Rodríguez, C., Hou, B.H., Molina, A., Schulze-Lefert, P., Lipka, V. and Somerville, S. (2006) Arabidopsis PEN3/PDR8, an ATP binding cassette transporter, contributes to nonhost resistance to inappropriate pathogens that enter by direct penetration. Plant Cell, 18, 731746.
  • Steppuhn, A., Gase, K., Krock, B., Halitschke, R. and Baldwin, I.T. (2004) Nicotine’s defensive function in nature. PLoS Biol.2, E217.
  • Strader, L.C. and Bartel, B. (2009) The Arabidopsis PLEIOTROPIC DRUG RESISTANCE8/ABCG36 ATP binding cassette transporter modulates sensitivity to the auxin precursor indole-3-butyric acid. Plant Cell, 21, 19922007.
  • Stukkens, Y., Bultreys, A., Grec, S., Trombik, T., Vanham, D. and Boutry, M. (2005) NpPDR1, a pleiotropic drug resistance-type ATP-binding cassette transporter from Nicotiana plumbaginifolia, plays a major role in plant pathogen defense. Plant Physiol.139, 341352.
  • Verrier, P.J., Bird, D., Burla, B. et al. (2008) Plant ABC proteins – a unified nomenclature and updated inventory. Trends Plant Sci.13, 151159.
  • Welter, S.C. (1989) Arthropod impact on plant gas exchange. In Insect–Plant Interactions, Vol. 1 (Bernays, E.A., ed.). Boca Raton, FL: CRC Press, pp. 135150.
  • Wu, J. and Baldwin, I.T. (2010) New insights into plant responses to the attack from insect herbivores. Annu. Rev. Genet.44, 124.
  • Wu, J., Hettenhausen, C., Meldau, S. and Baldwin, I.T. (2007) Herbivory rapidly activates MAPK signaling in attacked and unattacked leaf regions but not between leaves of Nicotiana attenuata. Plant Cell, 19, 10961122.
  • Yazaki, K., Shitan, N., Sugiyama, A. and Takanashi, K. (2009) Cell and molecular biology of ATP-binding cassette proteins in plants. Int. Rev. Cell Mol. Biol.276, 263299.
  • Zavala, J.A. and Baldwin, I.T. (2004) Fitness benefits of trypsin proteinase inhibitor expression in Nicotiana attenuata are greater than their costs when plants are attacked. BMC Ecol.4, 11.

Supporting Information

  1. Top of page
  2. Summary
  3. Introduction
  4. Results
  5. Discussion
  6. Experimental procedures
  7. Acknowledgments
  8. References
  9. Supporting Information

Figure S1. Elements in the promoter sequence ofABCG5/PDR5. The ABCG5/PDR5 transcription promoter region contains a stop codon at position -18 (bold) in frame with the translation initiation codon (bold and underlined), and a T/G-box at position -456 bp (italics and bold).

Figure S2. Phylogenetic analysis of PDRtransporters from different species. PDR amino acid sequences fromNt (N. tabacum), Np (N. plumbaginifolia), At(Arabidopsis thaliana), Os (Oryza sativa), Gm(Glycine max), Sp (Spirodela polyrrhiza) werecompared using the CLUSTALW program and an unrootedneighbor-joining tree generated(http://mobyle.pasteur.fr/cgi-bin/portal.py#forms::clustalw-multialign).The novel ABCG5/PDR5 isoforms of N. tabacum and N.plumbaginifolia are shown in blue. Bootstrap values for the branches are shown. The distance scale represents the evolutionary distance expressed as the number of substitutions per amino acid.

Figure S3. Sequence motifs in ABCG5/PDR5. ABCG5/PDR5, here exemplified by NtPDR5a, contains the typical PDR motifs (gray), the Walker A and Walker B sequence motifs and the ABC signature motifs (highlighted).

Figure S4. Immunogenic sequence of the ABCG5/PDR5 antibody. A 61 amino acid sequence in a unique region of ABCG5/PDR5 (underlined) was chosen for immunizing rabbits and obtaining an isoform specific antibody.

Figure S5. Subcellular localization of PDR5 inN. tabacum. (a-f) Localization of the GFP-PDR5 (a) andPDR5-GFP (d) fusion proteins and the plasma membrane marker FM4-64(b and e), and the merged images (c and f) in a single planeconfocal image. Bars = 10 μm.

Figure S6. Illustration of wounding of N.tabacum plants. Wounding was either realized using forceps pressure or a fabric pattern to perforate the leaf tissue. A control sample was always taken from a non-injured area on the same leaf.

Figure S7. Silencing of ABCG5/PDR5 doesnot affect PDR1 expression. Microsomal fractions of hydroponicallygrown N. tabacum roots were isolated and subjected toimmunoblotting with an ABCG5/PDR5-specific antibody, aPDR1-specific antibody and a general anti-H+-ATPaseantibody as a loading control.

Figure S8. Silencing of NpPDR1 in N.tabacum. NpPDR1 expression was silenced by RNAinterference as previously described in Stukkens et al. (2005).Microsomal fractions of hydroponically grown N. tabacumroots were isolated and subjected to immunoblotting with aNpPDR1-specific antibody and a general anti-H+-ATPaseantibody as a loading control. Two independet lines,Nppdr1-1 and Nppdr1-2, were analyzed induplicates.

Figure S9. HPLC chromatograph of N.tabacum leaf extracts and selected peak quantification.Methanolic leaf extracts from wild type, pdr5-1, andpdr5-2 were separated and quantified by HPLC-UV.Concentrations of Nicotine (a), Chlorogenic Acid (b), DicaffeoylSpermidine (c), or Rutin (d) in wild type, pdr5-1, andpdr5-2, that were wounded and treated with oral secretions.Error bars represent standard deviation; no significant differencewas found between the different extracts.

Figure S10. Soluble sugars analysis of N.tabacum leaf extracts. Concentrations of the soluble sugarsGlucose (a), Fructose (b), and Sucrose (c) in leaf extracts fromwild type, pdr5-1, and pdr5-2 plants were determined using an ethanolic extraction and a coupled enzymatic assay; concentrations shown were measured at absorbance 340 nm. Error bars represent standard error; no significant difference in any quantified sugar was found between the extracts.

Figure S11. Primers used for the amplificationof amiRNA constructs. Two artificial micro RNA (amiRNA) constructsdirected against regions in ABCG5/PDR5 were obtained asindicated in Methods and introduced in N. tabacum by A.tumefaciens mediated transformation.

As a service to our authors and readers, this journal provides supporting information supplied by the authors. Such materials are peer-reviewed and may be re-organized for online delivery, but are not copy-edited or typeset. Technical support issues arising from supporting information (other than missing files) should be addressed to the authors.

FilenameFormatSizeDescription
tpj5108_sm_FigS1.eps813KSupporting info item
tpj5108_sm_FigS10.eps875KSupporting info item
tpj5108_sm_FigS11.eps805KSupporting info item
tpj5108_sm_FigS2.eps1012KSupporting info item
tpj5108_sm_FigS3.eps1130KSupporting info item
tpj5108_sm_FigS4.eps889KSupporting info item
tpj5108_sm_FigS5.eps2495KSupporting info item
tpj5108_sm_FigS6.eps1398KSupporting info item
tpj5108_sm_FigS7.eps828KSupporting info item
tpj5108_sm_FigS8.eps1329KSupporting info item
tpj5108_sm_FigS9.eps1254KSupporting info item
tpj5108_sm_Supporting-Information-legends.doc31KSupporting info item

Please note: Wiley Blackwell is not responsible for the content or functionality of any supporting information supplied by the authors. Any queries (other than missing content) should be directed to the corresponding author for the article.